Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058

  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 67 pts. 9,490
  2. Avatar for Blipperman 22. Blipperman Lv 1 65 pts. 9,479
  3. Avatar for aznarog 23. aznarog Lv 1 64 pts. 9,474
  4. Avatar for diamond_dust 24. diamond_dust Lv 1 63 pts. 9,471
  5. Avatar for viosca 25. viosca Lv 1 61 pts. 9,470
  6. Avatar for deLaCeiba 26. deLaCeiba Lv 1 60 pts. 9,468
  7. Avatar for Vredeman 27. Vredeman Lv 1 59 pts. 9,467
  8. Avatar for hpaege 28. hpaege Lv 1 58 pts. 9,466
  9. Avatar for Timo van der Laan 29. Timo van der Laan Lv 1 56 pts. 9,464
  10. Avatar for uhuuhu 30. uhuuhu Lv 1 55 pts. 9,453

Comments