Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058

  1. Avatar for greepski 71. greepski Lv 1 20 pts. 9,308
  2. Avatar for shettler 72. shettler Lv 1 20 pts. 9,305
  3. Avatar for pvc78 73. pvc78 Lv 1 19 pts. 9,303
  4. Avatar for joremen 74. joremen Lv 1 19 pts. 9,303
  5. Avatar for sheerbliss 75. sheerbliss Lv 1 18 pts. 9,303
  6. Avatar for Kren 76. Kren Lv 1 18 pts. 9,300
  7. Avatar for alwen 77. alwen Lv 1 17 pts. 9,292
  8. Avatar for goastano 78. goastano Lv 1 17 pts. 9,284
  9. Avatar for frostschutz 79. frostschutz Lv 1 16 pts. 9,278
  10. Avatar for Crossed Sticks 80. Crossed Sticks Lv 1 16 pts. 9,269

Comments