Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for Ms. Carter's Jr. Science Classes 22. Ms. Carter's Jr. Science Classes 1 pt. 8,260
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058
  1. Avatar for which.chick 81. which.chick Lv 1 16 pts. 9,269
  2. Avatar for Mike Cassidy 82. Mike Cassidy Lv 1 15 pts. 9,268
  3. Avatar for WBarme1234 83. WBarme1234 Lv 1 15 pts. 9,267
  4. Avatar for harvardman 84. harvardman Lv 1 14 pts. 9,260
  5. Avatar for fryguy 85. fryguy Lv 1 14 pts. 9,259
  6. Avatar for hada 86. hada Lv 1 14 pts. 9,251
  7. Avatar for dizzywings 87. dizzywings Lv 1 13 pts. 9,248
  8. Avatar for dbuske 88. dbuske Lv 1 13 pts. 9,243
  9. Avatar for t012 89. t012 Lv 1 12 pts. 9,242
  10. Avatar for TurtleByte 90. TurtleByte Lv 1 12 pts. 9,239

Comments