Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 9,610
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,578
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 9,554
  4. Avatar for Contenders 4. Contenders 49 pts. 9,546
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,535
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,526
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,500
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 9,468
  9. Avatar for Void Crushers 9. Void Crushers 11 pts. 9,464
  10. Avatar for Deleted group 10. Deleted group pts. 9,373

  1. Avatar for egran48 11. egran48 Lv 1 23 pts. 9,565
  2. Avatar for Deleted player 12. Deleted player pts. 9,564
  3. Avatar for dettingen 13. dettingen Lv 1 16 pts. 9,562
  4. Avatar for retiredmichael 14. retiredmichael Lv 1 14 pts. 9,561
  5. Avatar for Galaxie 15. Galaxie Lv 1 11 pts. 9,554
  6. Avatar for brgreening 16. brgreening Lv 1 9 pts. 9,550
  7. Avatar for MaartenDesnouck 17. MaartenDesnouck Lv 1 8 pts. 9,550
  8. Avatar for phi16 18. phi16 Lv 1 6 pts. 9,548
  9. Avatar for gmn 19. gmn Lv 1 5 pts. 9,547
  10. Avatar for gitwut 20. gitwut Lv 1 4 pts. 9,542

Comments