Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 9,610
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,578
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 9,554
  4. Avatar for Contenders 4. Contenders 49 pts. 9,546
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,535
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,526
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,500
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 9,468
  9. Avatar for Void Crushers 9. Void Crushers 11 pts. 9,464
  10. Avatar for Deleted group 10. Deleted group pts. 9,373

  1. Avatar for RyeSnake 91. RyeSnake Lv 1 12 pts. 9,233
  2. Avatar for Glen B 92. Glen B Lv 1 11 pts. 9,227
  3. Avatar for ViJay7019 93. ViJay7019 Lv 1 11 pts. 9,224
  4. Avatar for YeshuaLives 94. YeshuaLives Lv 1 11 pts. 9,222
  5. Avatar for kitek314_pl 95. kitek314_pl Lv 1 10 pts. 9,222
  6. Avatar for cbwest 96. cbwest Lv 1 10 pts. 9,219
  7. Avatar for hansvandenhof 97. hansvandenhof Lv 1 10 pts. 9,215
  8. Avatar for leehaggis 98. leehaggis Lv 1 10 pts. 9,214
  9. Avatar for amylindalou 99. amylindalou Lv 1 9 pts. 9,214
  10. Avatar for froggs554 100. froggs554 Lv 1 9 pts. 9,195

Comments