Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 9,610
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,578
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 9,554
  4. Avatar for Contenders 4. Contenders 49 pts. 9,546
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,535
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,526
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,500
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 9,468
  9. Avatar for Void Crushers 9. Void Crushers 11 pts. 9,464
  10. Avatar for Deleted group 10. Deleted group pts. 9,373

  1. Avatar for martinf 161. martinf Lv 1 1 pt. 8,861
  2. Avatar for Truncheon Luncheon 162. Truncheon Luncheon Lv 1 1 pt. 8,858
  3. Avatar for dstefanescu 163. dstefanescu Lv 1 1 pt. 8,851
  4. Avatar for lamoille 164. lamoille Lv 1 1 pt. 8,846
  5. Avatar for Auntecedent 165. Auntecedent Lv 1 1 pt. 8,842
  6. Avatar for Ronin-Sensei 166. Ronin-Sensei Lv 1 1 pt. 8,842
  7. Avatar for Mydogisa Toelicker 167. Mydogisa Toelicker Lv 1 1 pt. 8,840
  8. Avatar for Czim 169. Czim Lv 1 1 pt. 8,823
  9. Avatar for Silhouette 170. Silhouette Lv 1 1 pt. 8,816

Comments