Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 9,610
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,578
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 9,554
  4. Avatar for Contenders 4. Contenders 49 pts. 9,546
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,535
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,526
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,500
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 9,468
  9. Avatar for Void Crushers 9. Void Crushers 11 pts. 9,464
  10. Avatar for Deleted group 10. Deleted group pts. 9,373

  1. Avatar for frood66 11. frood66 Lv 1 82 pts. 9,525
  2. Avatar for Deleted player 12. Deleted player pts. 9,517
  3. Avatar for grogar7 13. grogar7 Lv 1 79 pts. 9,516
  4. Avatar for KarenCH 14. KarenCH Lv 1 77 pts. 9,514
  5. Avatar for actiasluna 15. actiasluna Lv 1 76 pts. 9,513
  6. Avatar for nicobul 16. nicobul Lv 1 74 pts. 9,500
  7. Avatar for Museka 17. Museka Lv 1 73 pts. 9,499
  8. Avatar for gitwut 18. gitwut Lv 1 71 pts. 9,499
  9. Avatar for gloverd 19. gloverd Lv 1 70 pts. 9,498
  10. Avatar for bertro 20. bertro Lv 1 68 pts. 9,491

Comments