Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,610
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,578
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 9,554
  4. Avatar for Contenders 4. Contenders 49 pts. 9,546
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,535
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,526
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,500
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 9,468
  9. Avatar for Void Crushers 9. Void Crushers 11 pts. 9,464
  10. Avatar for Deleted group 10. Deleted group pts. 9,373
  1. Avatar for aldgwarlock04 241. aldgwarlock04 Lv 1 1 pt. 8,193
  2. Avatar for JXPZ 242. JXPZ Lv 1 1 pt. 8,149
  3. Avatar for brgreening 243. brgreening Lv 1 1 pt. 8,125
  4. Avatar for minhcao 244. minhcao Lv 1 1 pt. 8,069
  5. Avatar for aspadistra 245. aspadistra Lv 1 1 pt. 8,058
  6. Avatar for swordofnobody 246. swordofnobody Lv 1 1 pt. 7,858
  7. Avatar for woof689 247. woof689 Lv 1 1 pt. 7,762
  8. Avatar for bkoep 248. bkoep Lv 1 1 pt. 7,713
  9. Avatar for zkm 249. zkm Lv 1 1 pt. 7,685
  10. Avatar for Bailey96 250. Bailey96 Lv 1 1 pt. 7,522

Comments