Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,357
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,286
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 9,068
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,903
  5. Avatar for xkcd 15. xkcd 1 pt. 8,863
  6. Avatar for freefolder 16. freefolder 1 pt. 8,841
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,661
  8. Avatar for Alpha Folders 19. Alpha Folders 1 pt. 8,501
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,461

  1. Avatar for Scopper 111. Scopper Lv 1 7 pts. 9,033
  2. Avatar for harvardman 112. harvardman Lv 1 6 pts. 9,031
  3. Avatar for mitarcher 113. mitarcher Lv 1 6 pts. 9,029
  4. Avatar for Czim 114. Czim Lv 1 6 pts. 9,028
  5. Avatar for YGK 115. YGK Lv 1 6 pts. 9,021
  6. Avatar for pfirth 116. pfirth Lv 1 6 pts. 9,020
  7. Avatar for arginia 117. arginia Lv 1 5 pts. 9,009
  8. Avatar for Mark- 118. Mark- Lv 1 5 pts. 9,008
  9. Avatar for Deleted player 119. Deleted player pts. 9,003
  10. Avatar for Jim Fraser 120. Jim Fraser Lv 1 5 pts. 8,992

Comments