Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,357
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,286
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 9,068
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,903
  5. Avatar for xkcd 15. xkcd 1 pt. 8,863
  6. Avatar for freefolder 16. freefolder 1 pt. 8,841
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,661
  8. Avatar for NYIT OW BIOL-340 Fall 2015 18. NYIT OW BIOL-340 Fall 2015 1 pt. 8,557
  9. Avatar for Alpha Folders 19. Alpha Folders 1 pt. 8,501
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,461
  1. Avatar for jebbiek 121. jebbiek Lv 1 5 pts. 8,992
  2. Avatar for Mohambone 122. Mohambone Lv 1 5 pts. 8,986
  3. Avatar for rg_sar 123. rg_sar Lv 1 4 pts. 8,985
  4. Avatar for FreeFolder 124. FreeFolder Lv 1 4 pts. 8,980
  5. Avatar for SouperGenious 125. SouperGenious Lv 1 4 pts. 8,967
  6. Avatar for rezaefar 126. rezaefar Lv 1 4 pts. 8,967
  7. Avatar for Ernst Zundel 127. Ernst Zundel Lv 1 4 pts. 8,954
  8. Avatar for Mike Cassidy 128. Mike Cassidy Lv 1 4 pts. 8,949
  9. Avatar for Colostomy EXPLOSION. 129. Colostomy EXPLOSION. Lv 1 4 pts. 8,945
  10. Avatar for PrettyPony2001 130. PrettyPony2001 Lv 1 4 pts. 8,944

Comments