Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,357
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,286
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 9,068
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,903
  5. Avatar for xkcd 15. xkcd 1 pt. 8,863
  6. Avatar for freefolder 16. freefolder 1 pt. 8,841
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,661
  8. Avatar for Alpha Folders 19. Alpha Folders 1 pt. 8,501
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,461

  1. Avatar for Greenlee 171. Greenlee Lv 1 1 pt. 8,758
  2. Avatar for kboosh 172. kboosh Lv 1 1 pt. 8,758
  3. Avatar for DScott 173. DScott Lv 1 1 pt. 8,755
  4. Avatar for mirjamvandelft 174. mirjamvandelft Lv 1 1 pt. 8,746
  5. Avatar for marie.c 175. marie.c Lv 1 1 pt. 8,744
  6. Avatar for momadoc 176. momadoc Lv 1 1 pt. 8,740
  7. Avatar for Maru67 177. Maru67 Lv 1 1 pt. 8,739
  8. Avatar for NotJim99 178. NotJim99 Lv 1 1 pt. 8,738
  9. Avatar for Corruption 179. Corruption Lv 1 1 pt. 8,735
  10. Avatar for Radeodem8 180. Radeodem8 Lv 1 1 pt. 8,726

Comments