Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,357
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,286
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 9,068
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,903
  5. Avatar for xkcd 15. xkcd 1 pt. 8,863
  6. Avatar for freefolder 16. freefolder 1 pt. 8,841
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,661
  8. Avatar for Alpha Folders 19. Alpha Folders 1 pt. 8,501
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,461

  1. Avatar for melonypatel 201. melonypatel Lv 1 1 pt. 8,606
  2. Avatar for mariasequ 202. mariasequ Lv 1 1 pt. 8,600
  3. Avatar for Cerzax 203. Cerzax Lv 1 1 pt. 8,592
  4. Avatar for Silhouette 204. Silhouette Lv 1 1 pt. 8,587
  5. Avatar for Greenbob99 205. Greenbob99 Lv 1 1 pt. 8,580
  6. Avatar for cnhrcolemam 206. cnhrcolemam Lv 1 1 pt. 8,580
  7. Avatar for DaneSisko 207. DaneSisko Lv 1 1 pt. 8,577
  8. Avatar for Fowardint 208. Fowardint Lv 1 1 pt. 8,576
  9. Avatar for 01010011111 209. 01010011111 Lv 1 1 pt. 8,572
  10. Avatar for Harry_Schmitt 210. Harry_Schmitt Lv 1 1 pt. 8,566

Comments