Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,357
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,286
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 9,068
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,903
  5. Avatar for xkcd 15. xkcd 1 pt. 8,863
  6. Avatar for freefolder 16. freefolder 1 pt. 8,841
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,661
  8. Avatar for Alpha Folders 19. Alpha Folders 1 pt. 8,501
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,461

  1. Avatar for Wheeler22 221. Wheeler22 Lv 1 1 pt. 8,512
  2. Avatar for Greenvsemenov 222. Greenvsemenov Lv 1 1 pt. 8,512
  3. Avatar for geniusammyr 223. geniusammyr Lv 1 1 pt. 8,509
  4. Avatar for minkim2015 224. minkim2015 Lv 1 1 pt. 8,501
  5. Avatar for brgreening 225. brgreening Lv 1 1 pt. 8,497
  6. Avatar for cconger 226. cconger Lv 1 1 pt. 8,484
  7. Avatar for vbj2 17 227. vbj2 17 Lv 1 1 pt. 8,483
  8. Avatar for SaDeB2015 228. SaDeB2015 Lv 1 1 pt. 8,463
  9. Avatar for Mingrui Leng 229. Mingrui Leng Lv 1 1 pt. 8,462
  10. Avatar for aspadistra 230. aspadistra Lv 1 1 pt. 8,461

Comments