Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,357
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,286
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 9,068
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,903
  5. Avatar for xkcd 15. xkcd 1 pt. 8,863
  6. Avatar for freefolder 16. freefolder 1 pt. 8,841
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,661
  8. Avatar for NYIT OW BIOL-340 Fall 2015 18. NYIT OW BIOL-340 Fall 2015 1 pt. 8,557
  9. Avatar for Alpha Folders 19. Alpha Folders 1 pt. 8,501
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,461
  1. Avatar for froggs554 81. froggs554 Lv 1 16 pts. 9,195
  2. Avatar for SKSbell 82. SKSbell Lv 1 15 pts. 9,194
  3. Avatar for t012 83. t012 Lv 1 15 pts. 9,191
  4. Avatar for fpc 84. fpc Lv 1 15 pts. 9,181
  5. Avatar for inkycatz 85. inkycatz Lv 1 14 pts. 9,179
  6. Avatar for TomTaylor 86. TomTaylor Lv 1 14 pts. 9,174
  7. Avatar for hansvandenhof 87. hansvandenhof Lv 1 13 pts. 9,169
  8. Avatar for Dempy 88. Dempy Lv 1 13 pts. 9,164
  9. Avatar for smholst 89. smholst Lv 1 13 pts. 9,157
  10. Avatar for Norrjane 90. Norrjane Lv 1 12 pts. 9,148

Comments