Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,670

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,639
  2. Avatar for Deleted player 2. Deleted player 89 pts. 9,638
  3. Avatar for LociOiling 3. LociOiling Lv 1 78 pts. 9,638
  4. Avatar for reefyrob 4. reefyrob Lv 1 69 pts. 9,637
  5. Avatar for Deleted player 5. Deleted player pts. 9,632
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 53 pts. 9,630
  7. Avatar for bertro 7. bertro Lv 1 46 pts. 9,627
  8. Avatar for brgreening 8. brgreening Lv 1 40 pts. 9,613
  9. Avatar for mirp 9. mirp Lv 1 34 pts. 9,603
  10. Avatar for Paulo Roque 10. Paulo Roque Lv 1 29 pts. 9,603

Comments