Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,670

  1. Avatar for Deleted player pts. 9,634
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 99 pts. 9,602
  3. Avatar for johnmitch 3. johnmitch Lv 1 97 pts. 9,580
  4. Avatar for LociOiling 4. LociOiling Lv 1 95 pts. 9,571
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 93 pts. 9,570
  6. Avatar for mirp 6. mirp Lv 1 91 pts. 9,570
  7. Avatar for egran48 7. egran48 Lv 1 89 pts. 9,562
  8. Avatar for pauldunn 8. pauldunn Lv 1 88 pts. 9,560
  9. Avatar for KarenCH 9. KarenCH Lv 1 86 pts. 9,551
  10. Avatar for lynnai 10. lynnai Lv 1 84 pts. 9,537

Comments