Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,670

  1. Avatar for Psych0Active 91. Psych0Active Lv 1 12 pts. 9,135
  2. Avatar for Alistair69 92. Alistair69 Lv 1 12 pts. 9,132
  3. Avatar for dbuske 93. dbuske Lv 1 11 pts. 9,127
  4. Avatar for ecali 94. ecali Lv 1 11 pts. 9,111
  5. Avatar for ViJay7019 95. ViJay7019 Lv 1 11 pts. 9,111
  6. Avatar for eusair 96. eusair Lv 1 10 pts. 9,104
  7. Avatar for manu8170 97. manu8170 Lv 1 10 pts. 9,100
  8. Avatar for Vinara 98. Vinara Lv 1 10 pts. 9,096
  9. Avatar for MaartenDesnouck 99. MaartenDesnouck Lv 1 9 pts. 9,095
  10. Avatar for hada 100. hada Lv 1 9 pts. 9,093

Comments