Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,670

  1. Avatar for tela 101. tela Lv 1 9 pts. 9,093
  2. Avatar for guineapig 102. guineapig Lv 1 9 pts. 9,081
  3. Avatar for BCAA 103. BCAA Lv 1 8 pts. 9,068
  4. Avatar for ManVsYard 104. ManVsYard Lv 1 8 pts. 9,065
  5. Avatar for steveB 105. steveB Lv 1 8 pts. 9,062
  6. Avatar for JUMELLE54 106. JUMELLE54 Lv 1 8 pts. 9,051
  7. Avatar for caglar 107. caglar Lv 1 7 pts. 9,047
  8. Avatar for bamh 108. bamh Lv 1 7 pts. 9,044
  9. Avatar for ppp6 109. ppp6 Lv 1 7 pts. 9,042
  10. Avatar for GreekCivilization 110. GreekCivilization Lv 1 7 pts. 9,039

Comments