Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,670
  1. Avatar for Scopper 111. Scopper Lv 1 7 pts. 9,033
  2. Avatar for harvardman 112. harvardman Lv 1 6 pts. 9,031
  3. Avatar for mitarcher 113. mitarcher Lv 1 6 pts. 9,029
  4. Avatar for Czim 114. Czim Lv 1 6 pts. 9,028
  5. Avatar for YGK 115. YGK Lv 1 6 pts. 9,021
  6. Avatar for pfirth 116. pfirth Lv 1 6 pts. 9,020
  7. Avatar for arginia 117. arginia Lv 1 5 pts. 9,009
  8. Avatar for Mark- 118. Mark- Lv 1 5 pts. 9,008
  9. Avatar for Deleted player 119. Deleted player pts. 9,003
  10. Avatar for Jim Fraser 120. Jim Fraser Lv 1 5 pts. 8,992

Comments