Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,670
  1. Avatar for val.sch67 151. val.sch67 Lv 1 2 pts. 8,867
  2. Avatar for fryguy 152. fryguy Lv 1 2 pts. 8,863
  3. Avatar for Soggy Doglog 153. Soggy Doglog Lv 1 2 pts. 8,861
  4. Avatar for armaholik 154. armaholik Lv 1 2 pts. 8,854
  5. Avatar for Festering Wounds 155. Festering Wounds Lv 1 2 pts. 8,854
  6. Avatar for Iron pet 156. Iron pet Lv 1 1 pt. 8,851
  7. Avatar for flyflipper102 157. flyflipper102 Lv 1 1 pt. 8,849
  8. Avatar for Altercomp 158. Altercomp Lv 1 1 pt. 8,841
  9. Avatar for NameChangeNeeded01 159. NameChangeNeeded01 Lv 1 1 pt. 8,841
  10. Avatar for JackONeill12 160. JackONeill12 Lv 1 1 pt. 8,834

Comments