Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,670

  1. Avatar for Galaxie 11. Galaxie Lv 1 82 pts. 9,532
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 81 pts. 9,531
  3. Avatar for mimi 13. mimi Lv 1 79 pts. 9,526
  4. Avatar for gloverd 14. gloverd Lv 1 78 pts. 9,522
  5. Avatar for smilingone 15. smilingone Lv 1 76 pts. 9,517
  6. Avatar for gitwut 16. gitwut Lv 1 74 pts. 9,512
  7. Avatar for uhuuhu 17. uhuuhu Lv 1 73 pts. 9,502
  8. Avatar for nicobul 18. nicobul Lv 1 71 pts. 9,495
  9. Avatar for Deleted player 19. Deleted player 70 pts. 9,489
  10. Avatar for bertro 20. bertro Lv 1 69 pts. 9,484

Comments