Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,670

  1. Avatar for jjfolder 211. jjfolder Lv 1 1 pt. 8,565
  2. Avatar for Pibeagles 212. Pibeagles Lv 1 1 pt. 8,565
  3. Avatar for stitchdeng 213. stitchdeng Lv 1 1 pt. 8,559
  4. Avatar for Iktorija 214. Iktorija Lv 1 1 pt. 8,558
  5. Avatar for jchack10 215. jchack10 Lv 1 1 pt. 8,557
  6. Avatar for xavisebastia96 216. xavisebastia96 Lv 1 1 pt. 8,554
  7. Avatar for Ronin-Sensei 217. Ronin-Sensei Lv 1 1 pt. 8,536
  8. Avatar for megabio 218. megabio Lv 1 1 pt. 8,526
  9. Avatar for chris.owens 219. chris.owens Lv 1 1 pt. 8,521
  10. Avatar for emdee314 220. emdee314 Lv 1 1 pt. 8,521

Comments