Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,670

  1. Avatar for lesylv1 231. lesylv1 Lv 1 1 pt. 8,405
  2. Avatar for LukaTheWizard 232. LukaTheWizard Lv 1 1 pt. 8,393
  3. Avatar for JaumeLillo 233. JaumeLillo Lv 1 1 pt. 8,374
  4. Avatar for marsfan 234. marsfan Lv 1 1 pt. 8,353
  5. Avatar for smithbjammin 235. smithbjammin Lv 1 1 pt. 8,303
  6. Avatar for Bernis 236. Bernis Lv 1 1 pt. 8,273
  7. Avatar for Folder0802 237. Folder0802 Lv 1 1 pt. 8,233
  8. Avatar for Risumbra 238. Risumbra Lv 1 1 pt. 8,220
  9. Avatar for vamseedhar_r 239. vamseedhar_r Lv 1 1 pt. 8,067
  10. Avatar for Arne Heessels 240. Arne Heessels Lv 1 1 pt. 8,027

Comments