Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,670

  1. Avatar for Museka 21. Museka Lv 1 67 pts. 9,482
  2. Avatar for frood66 22. frood66 Lv 1 66 pts. 9,473
  3. Avatar for nemo7731 23. nemo7731 Lv 1 64 pts. 9,464
  4. Avatar for Deleted player 24. Deleted player pts. 9,464
  5. Avatar for g_b 25. g_b Lv 1 62 pts. 9,461
  6. Avatar for Bletchley Park 26. Bletchley Park Lv 1 60 pts. 9,451
  7. Avatar for Giant Berk 27. Giant Berk Lv 1 59 pts. 9,443
  8. Avatar for cobaltteal 28. cobaltteal Lv 1 58 pts. 9,443
  9. Avatar for viosca 29. viosca Lv 1 57 pts. 9,441
  10. Avatar for goastano 30. goastano Lv 1 55 pts. 9,441

Comments