Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,670
  1. Avatar for jamiexq 61. jamiexq Lv 1 27 pts. 9,314
  2. Avatar for faues 62. faues Lv 1 26 pts. 9,301
  3. Avatar for deLaCeiba 63. deLaCeiba Lv 1 25 pts. 9,300
  4. Avatar for stomjoh 64. stomjoh Lv 1 25 pts. 9,297
  5. Avatar for jermainiac 65. jermainiac Lv 1 24 pts. 9,291
  6. Avatar for fishercat 66. fishercat Lv 1 24 pts. 9,290
  7. Avatar for Paulo Roque 67. Paulo Roque Lv 1 23 pts. 9,286
  8. Avatar for kitek314_pl 68. kitek314_pl Lv 1 22 pts. 9,286
  9. Avatar for crpainter 69. crpainter Lv 1 22 pts. 9,278
  10. Avatar for actiasluna 70. actiasluna Lv 1 21 pts. 9,278

Comments