1170: Revisiting Puzzle 115: Exocyst
Closed since about 10 years ago
Intermediate Overall PredictionSummary
- Created
- December 16, 2015
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK
Top groups
-
1. Beta Folders100 pts. 9,639
-
-
-
-
-
-
-
-
-
-
1. smilingone Lv 1100 pts. 9,639 -
-
-
-
-
-
-
-
-
Comments
jeff101 Lv 1
The Power of Foldit Compels You!