Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,639
  2. Avatar for Go Science 2. Go Science 78 pts. 9,603
  3. Avatar for Contenders 3. Contenders 60 pts. 9,575
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,570
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,551
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,495
  7. Avatar for Gargleblasters 7. Gargleblasters 17 pts. 9,473
  8. Avatar for Deleted group 8. Deleted group pts. 9,464
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,438
  10. Avatar for Deleted group 10. Deleted group pts. 9,372
  1. Avatar for TomTaylor 21. TomTaylor Lv 1 4 pts. 9,551
  2. Avatar for Dempy 22. Dempy Lv 1 3 pts. 9,543
  3. Avatar for Galaxie 23. Galaxie Lv 1 3 pts. 9,531
  4. Avatar for MaartenDesnouck 24. MaartenDesnouck Lv 1 2 pts. 9,519
  5. Avatar for gmn 25. gmn Lv 1 2 pts. 9,512
  6. Avatar for jamiexq 26. jamiexq Lv 1 1 pt. 9,504
  7. Avatar for grogar7 27. grogar7 Lv 1 1 pt. 9,502
  8. Avatar for phi16 28. phi16 Lv 1 1 pt. 9,495
  9. Avatar for Skippysk8s 29. Skippysk8s Lv 1 1 pt. 9,464
  10. Avatar for Blipperman 30. Blipperman Lv 1 1 pt. 9,447

Comments