Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,639
  2. Avatar for Go Science 2. Go Science 78 pts. 9,603
  3. Avatar for Contenders 3. Contenders 60 pts. 9,575
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,570
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,551
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,495
  7. Avatar for Gargleblasters 7. Gargleblasters 17 pts. 9,473
  8. Avatar for Deleted group 8. Deleted group pts. 9,464
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,438
  10. Avatar for Deleted group 10. Deleted group pts. 9,372

  1. Avatar for franse 181. franse Lv 1 1 pt. 8,725
  2. Avatar for YHello00 182. YHello00 Lv 1 1 pt. 8,708
  3. Avatar for Tac1 183. Tac1 Lv 1 1 pt. 8,703
  4. Avatar for oceanic1986 184. oceanic1986 Lv 1 1 pt. 8,702
  5. Avatar for parsnip 185. parsnip Lv 1 1 pt. 8,700
  6. Avatar for bwkittitas 186. bwkittitas Lv 1 1 pt. 8,690
  7. Avatar for GMYouLostYourKing 187. GMYouLostYourKing Lv 1 1 pt. 8,687
  8. Avatar for gruener-zwer 188. gruener-zwer Lv 1 1 pt. 8,685
  9. Avatar for bhodg1 189. bhodg1 Lv 1 1 pt. 8,685
  10. Avatar for Jacek Kijewski 190. Jacek Kijewski Lv 1 1 pt. 8,680

Comments