Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,639
  2. Avatar for Go Science 2. Go Science 78 pts. 9,603
  3. Avatar for Contenders 3. Contenders 60 pts. 9,575
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,570
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,551
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,495
  7. Avatar for Gargleblasters 7. Gargleblasters 17 pts. 9,473
  8. Avatar for Deleted group 8. Deleted group pts. 9,464
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,438
  10. Avatar for Deleted group 10. Deleted group pts. 9,372

  1. Avatar for Sydefecks 191. Sydefecks Lv 1 1 pt. 8,666
  2. Avatar for HorribleIgor 192. HorribleIgor Lv 1 1 pt. 8,663
  3. Avatar for doctaven 193. doctaven Lv 1 1 pt. 8,661
  4. Avatar for bonn3298 194. bonn3298 Lv 1 1 pt. 8,645
  5. Avatar for alcor29 195. alcor29 Lv 1 1 pt. 8,643
  6. Avatar for lacie 196. lacie Lv 1 1 pt. 8,643
  7. Avatar for JaimeUAB 197. JaimeUAB Lv 1 1 pt. 8,638
  8. Avatar for Tichita1 198. Tichita1 Lv 1 1 pt. 8,633
  9. Avatar for pandabearsecond 199. pandabearsecond Lv 1 1 pt. 8,616
  10. Avatar for stephenrl 200. stephenrl Lv 1 1 pt. 8,614

Comments