Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,639
  2. Avatar for Go Science 2. Go Science 78 pts. 9,603
  3. Avatar for Contenders 3. Contenders 60 pts. 9,575
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,570
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,551
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,495
  7. Avatar for Gargleblasters 7. Gargleblasters 17 pts. 9,473
  8. Avatar for Deleted group 8. Deleted group pts. 9,464
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,438
  10. Avatar for Deleted group 10. Deleted group pts. 9,372

  1. Avatar for jflat06 251. jflat06 Lv 1 1 pt. 6,670
  2. Avatar for weter700 252. weter700 Lv 1 1 pt. 6,662
  3. Avatar for gaoyanan 253. gaoyanan Lv 1 1 pt. 6,662
  4. Avatar for SALiquidSilver 254. SALiquidSilver Lv 1 1 pt. 6,662
  5. Avatar for dettingen 255. dettingen Lv 1 1 pt. 6,662
  6. Avatar for packer 256. packer Lv 1 1 pt. 6,662
  7. Avatar for Akmido Kazadaky 257. Akmido Kazadaky Lv 1 1 pt. 6,662

Comments