Placeholder image of a protein
Icon representing a puzzle

1170: Revisiting Puzzle 115: Exocyst

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 16, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,639
  2. Avatar for Go Science 2. Go Science 78 pts. 9,603
  3. Avatar for Contenders 3. Contenders 60 pts. 9,575
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,570
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,551
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,495
  7. Avatar for Gargleblasters 7. Gargleblasters 17 pts. 9,473
  8. Avatar for Deleted group 8. Deleted group pts. 9,464
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,438
  10. Avatar for Deleted group 10. Deleted group pts. 9,372
  1. Avatar for gameupshark 241. gameupshark Lv 1 1 pt. 8,014
  2. Avatar for Dobby54 242. Dobby54 Lv 1 1 pt. 8,005
  3. Avatar for Xelandria Darks 243. Xelandria Darks Lv 1 1 pt. 7,918
  4. Avatar for elanes 244. elanes Lv 1 1 pt. 7,827
  5. Avatar for Quinn Peterson 245. Quinn Peterson Lv 1 1 pt. 7,821
  6. Avatar for Szyszunia2409 246. Szyszunia2409 Lv 1 1 pt. 7,765
  7. Avatar for Deleted player 247. Deleted player pts. 7,613
  8. Avatar for matrizona 248. matrizona Lv 1 1 pt. 7,546
  9. Avatar for witwarrior 249. witwarrior Lv 1 1 pt. 7,487
  10. Avatar for petetrig 250. petetrig Lv 1 1 pt. 6,947

Comments