Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,698
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,574
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,574
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,489
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,159
  6. Avatar for CureCoin 16. CureCoin 1 pt. 8,022
  7. Avatar for Czech National Team 17. Czech National Team 1 pt. 7,953
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 1 pt. 7,916
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 0

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 8,834
  2. Avatar for smilingone 2. smilingone Lv 1 84 pts. 8,834
  3. Avatar for Galaxie 3. Galaxie Lv 1 70 pts. 8,834
  4. Avatar for reefyrob 4. reefyrob Lv 1 57 pts. 8,832
  5. Avatar for gmn 5. gmn Lv 1 47 pts. 8,831
  6. Avatar for brgreening 6. brgreening Lv 1 38 pts. 8,830
  7. Avatar for alwen 7. alwen Lv 1 30 pts. 8,828
  8. Avatar for Deleted player 8. Deleted player pts. 8,828
  9. Avatar for diamond_dust 9. diamond_dust Lv 1 19 pts. 8,827
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 15 pts. 8,827

Comments