Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,698
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,574
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,574
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,489
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,159
  6. Avatar for CureCoin 16. CureCoin 1 pt. 8,022
  7. Avatar for Czech National Team 17. Czech National Team 1 pt. 7,953
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 1 pt. 7,916
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 0

  1. Avatar for SALiquidSilver 191. SALiquidSilver Lv 1 1 pt. 7,982
  2. Avatar for GRandall64 192. GRandall64 Lv 1 1 pt. 7,976
  3. Avatar for Lumir 193. Lumir Lv 1 1 pt. 7,953
  4. Avatar for KiRa937 194. KiRa937 Lv 1 1 pt. 7,922
  5. Avatar for TheQuantumStapler 195. TheQuantumStapler Lv 1 1 pt. 7,921
  6. Avatar for azndramaholic 196. azndramaholic Lv 1 1 pt. 7,916
  7. Avatar for Belle36 197. Belle36 Lv 1 1 pt. 7,895
  8. Avatar for MigiKiwi 198. MigiKiwi Lv 1 1 pt. 7,881
  9. Avatar for Galims 199. Galims Lv 1 1 pt. 7,869
  10. Avatar for cnhrcolemam 200. cnhrcolemam Lv 1 1 pt. 7,868

Comments