Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,698
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,574
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,574
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,489
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,159
  6. Avatar for CureCoin 16. CureCoin 1 pt. 8,022
  7. Avatar for Czech National Team 17. Czech National Team 1 pt. 7,953
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 1 pt. 7,916
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 0
  1. Avatar for HorribleIgor 201. HorribleIgor Lv 1 1 pt. 7,851
  2. Avatar for dawidziel101 202. dawidziel101 Lv 1 1 pt. 7,830
  3. Avatar for uihcv 203. uihcv Lv 1 1 pt. 7,825
  4. Avatar for polly66017 204. polly66017 Lv 1 1 pt. 7,720
  5. Avatar for th4yl0g 205. th4yl0g Lv 1 1 pt. 7,705
  6. Avatar for slowmo.chris 206. slowmo.chris Lv 1 1 pt. 7,615
  7. Avatar for BeckerM 207. BeckerM Lv 1 1 pt. 7,598
  8. Avatar for Modini 208. Modini Lv 1 1 pt. 7,439
  9. Avatar for hallenberg 209. hallenberg Lv 1 1 pt. 7,420
  10. Avatar for z1w1j 210. z1w1j Lv 1 1 pt. 7,418

Comments