Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Go Science 100 pts. 8,836
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 8,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 8,834
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 8,811
  5. Avatar for Contenders 5. Contenders 29 pts. 8,807
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 8,799
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 8,793
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 8,790
  9. Avatar for Gargleblasters 9. Gargleblasters 6 pts. 8,786
  10. Avatar for Deleted group 10. Deleted group pts. 8,742

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 8,834
  2. Avatar for smilingone 2. smilingone Lv 1 84 pts. 8,834
  3. Avatar for Galaxie 3. Galaxie Lv 1 70 pts. 8,834
  4. Avatar for reefyrob 4. reefyrob Lv 1 57 pts. 8,832
  5. Avatar for gmn 5. gmn Lv 1 47 pts. 8,831
  6. Avatar for brgreening 6. brgreening Lv 1 38 pts. 8,830
  7. Avatar for alwen 7. alwen Lv 1 30 pts. 8,828
  8. Avatar for Deleted player 8. Deleted player pts. 8,828
  9. Avatar for diamond_dust 9. diamond_dust Lv 1 19 pts. 8,827
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 15 pts. 8,827

Comments