Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Go Science 100 pts. 8,836
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 8,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 8,834
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 8,811
  5. Avatar for Contenders 5. Contenders 29 pts. 8,807
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 8,799
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 8,793
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 8,790
  9. Avatar for Gargleblasters 9. Gargleblasters 6 pts. 8,786
  10. Avatar for Deleted group 10. Deleted group pts. 8,742

  1. Avatar for SALiquidSilver 191. SALiquidSilver Lv 1 1 pt. 7,982
  2. Avatar for GRandall64 192. GRandall64 Lv 1 1 pt. 7,976
  3. Avatar for Lumir 193. Lumir Lv 1 1 pt. 7,953
  4. Avatar for KiRa937 194. KiRa937 Lv 1 1 pt. 7,922
  5. Avatar for TheQuantumStapler 195. TheQuantumStapler Lv 1 1 pt. 7,921
  6. Avatar for azndramaholic 196. azndramaholic Lv 1 1 pt. 7,916
  7. Avatar for Belle36 197. Belle36 Lv 1 1 pt. 7,895
  8. Avatar for MigiKiwi 198. MigiKiwi Lv 1 1 pt. 7,881
  9. Avatar for Galims 199. Galims Lv 1 1 pt. 7,869
  10. Avatar for cnhrcolemam 200. cnhrcolemam Lv 1 1 pt. 7,868

Comments