Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Go Science 100 pts. 8,836
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 8,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 8,834
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 8,811
  5. Avatar for Contenders 5. Contenders 29 pts. 8,807
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 8,799
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 8,793
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 8,790
  9. Avatar for Gargleblasters 9. Gargleblasters 6 pts. 8,786
  10. Avatar for Deleted group 10. Deleted group pts. 8,742

  1. Avatar for TomTaylor 21. TomTaylor Lv 1 62 pts. 8,791
  2. Avatar for Bushman 22. Bushman Lv 1 61 pts. 8,790
  3. Avatar for Galaxie 23. Galaxie Lv 1 59 pts. 8,788
  4. Avatar for Incongruous 24. Incongruous Lv 1 58 pts. 8,788
  5. Avatar for pmdpmd 25. pmdpmd Lv 1 56 pts. 8,788
  6. Avatar for g_b 26. g_b Lv 1 55 pts. 8,787
  7. Avatar for hpaege 27. hpaege Lv 1 54 pts. 8,786
  8. Avatar for Skippysk8s 28. Skippysk8s Lv 1 52 pts. 8,786
  9. Avatar for cobaltteal 29. cobaltteal Lv 1 51 pts. 8,785
  10. Avatar for Bletchley Park 30. Bletchley Park Lv 1 50 pts. 8,785

Comments