Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Go Science 100 pts. 8,836
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 8,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 8,834
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 8,811
  5. Avatar for Contenders 5. Contenders 29 pts. 8,807
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 8,799
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 8,793
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 8,790
  9. Avatar for Gargleblasters 9. Gargleblasters 6 pts. 8,786
  10. Avatar for Deleted group 10. Deleted group pts. 8,742

  1. Avatar for Glen B 51. Glen B Lv 1 28 pts. 8,757
  2. Avatar for nemo7731 52. nemo7731 Lv 1 27 pts. 8,757
  3. Avatar for sheerbliss 53. sheerbliss Lv 1 26 pts. 8,755
  4. Avatar for t012 54. t012 Lv 1 26 pts. 8,748
  5. Avatar for alwen 55. alwen Lv 1 25 pts. 8,748
  6. Avatar for Norrjane 56. Norrjane Lv 1 24 pts. 8,748
  7. Avatar for cherry39 57. cherry39 Lv 1 23 pts. 8,746
  8. Avatar for pvc78 58. pvc78 Lv 1 23 pts. 8,746
  9. Avatar for fpc 59. fpc Lv 1 22 pts. 8,744
  10. Avatar for Anfinsen_slept_here 60. Anfinsen_slept_here Lv 1 21 pts. 8,742

Comments