Placeholder image of a protein
Icon representing a puzzle

1173: Revisiting Puzzle 117: Transport Mutant

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Go Science 100 pts. 8,836
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 8,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 8,834
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 8,811
  5. Avatar for Contenders 5. Contenders 29 pts. 8,807
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 8,799
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 8,793
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 8,790
  9. Avatar for Gargleblasters 9. Gargleblasters 6 pts. 8,786
  10. Avatar for Deleted group 10. Deleted group pts. 8,742

  1. Avatar for Bruno Kestemont 61. Bruno Kestemont Lv 1 21 pts. 8,739
  2. Avatar for SKSbell 62. SKSbell Lv 1 20 pts. 8,737
  3. Avatar for hansvandenhof 63. hansvandenhof Lv 1 19 pts. 8,734
  4. Avatar for Superphosphate 64. Superphosphate Lv 1 19 pts. 8,733
  5. Avatar for JUMELLE54 65. JUMELLE54 Lv 1 18 pts. 8,732
  6. Avatar for gcm24 66. gcm24 Lv 1 18 pts. 8,732
  7. Avatar for SouperGenious 67. SouperGenious Lv 1 17 pts. 8,729
  8. Avatar for Merf 68. Merf Lv 1 17 pts. 8,728
  9. Avatar for YeshuaLives 69. YeshuaLives Lv 1 16 pts. 8,728
  10. Avatar for isaksson 70. isaksson Lv 1 16 pts. 8,726

Comments