Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,170
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,943
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,931
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,710
  6. Avatar for freefolder 16. freefolder 1 pt. 8,653
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,629
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,579
  9. Avatar for CureCoin 19. CureCoin 1 pt. 8,482
  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,453
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 87 pts. 9,450
  3. Avatar for TomTaylor 3. TomTaylor Lv 1 76 pts. 9,446
  4. Avatar for diamond_dust 4. diamond_dust Lv 1 65 pts. 9,443
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 56 pts. 9,442
  6. Avatar for gloverd 6. gloverd Lv 1 48 pts. 9,440
  7. Avatar for sheerbliss 7. sheerbliss Lv 1 41 pts. 9,440
  8. Avatar for pauldunn 8. pauldunn Lv 1 34 pts. 9,434
  9. Avatar for Scopper 9. Scopper Lv 1 29 pts. 9,429
  10. Avatar for mirp 10. mirp Lv 1 24 pts. 9,422

Comments