Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,170
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,943
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,931
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,710
  6. Avatar for freefolder 16. freefolder 1 pt. 8,653
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,629
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,579
  9. Avatar for CureCoin 19. CureCoin 1 pt. 8,482
  1. Avatar for martinf 131. martinf Lv 1 2 pts. 8,865
  2. Avatar for Inkedhands 132. Inkedhands Lv 1 2 pts. 8,852
  3. Avatar for penteplayer 133. penteplayer Lv 1 1 pt. 8,848
  4. Avatar for harvardman 134. harvardman Lv 1 1 pt. 8,846
  5. Avatar for gdnskye 135. gdnskye Lv 1 1 pt. 8,840
  6. Avatar for Dempy 136. Dempy Lv 1 1 pt. 8,839
  7. Avatar for DScott 137. DScott Lv 1 1 pt. 8,836
  8. Avatar for Ronin-Sensei 138. Ronin-Sensei Lv 1 1 pt. 8,824
  9. Avatar for Radeodem8 139. Radeodem8 Lv 1 1 pt. 8,815
  10. Avatar for navn 140. navn Lv 1 1 pt. 8,808

Comments