Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,170
  2. Avatar for Russian team 12. Russian team 1 pt. 9,165
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,943
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,931
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,710
  6. Avatar for freefolder 16. freefolder 1 pt. 8,653
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,629
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,579
  9. Avatar for CureCoin 19. CureCoin 1 pt. 8,482
  1. Avatar for t012 71. t012 Lv 1 15 pts. 9,112
  2. Avatar for aznarog 72. aznarog Lv 1 14 pts. 9,104
  3. Avatar for stomjoh 73. stomjoh Lv 1 14 pts. 9,096
  4. Avatar for Crossed Sticks 74. Crossed Sticks Lv 1 14 pts. 9,086
  5. Avatar for eusair 75. eusair Lv 1 13 pts. 9,080
  6. Avatar for Incongruous 76. Incongruous Lv 1 13 pts. 9,078
  7. Avatar for SKSbell 77. SKSbell Lv 1 12 pts. 9,076
  8. Avatar for bamh 78. bamh Lv 1 12 pts. 9,073
  9. Avatar for flyflipper102 79. flyflipper102 Lv 1 11 pts. 9,067
  10. Avatar for fpc 80. fpc Lv 1 11 pts. 9,062

Comments