Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Contenders 100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228

  1. Avatar for Pro Lapser 121. Pro Lapser Lv 1 2 pts. 8,905
  2. Avatar for TJOK fan 122. TJOK fan Lv 1 2 pts. 8,903
  3. Avatar for inkycatz 123. inkycatz Lv 1 2 pts. 8,901
  4. Avatar for Ernst Zundel 124. Ernst Zundel Lv 1 2 pts. 8,899
  5. Avatar for Dantoto 125. Dantoto Lv 1 2 pts. 8,898
  6. Avatar for Truncheon Luncheon 126. Truncheon Luncheon Lv 1 2 pts. 8,894
  7. Avatar for IHGreenman 127. IHGreenman Lv 1 2 pts. 8,891
  8. Avatar for jamiexq 128. jamiexq Lv 1 2 pts. 8,890
  9. Avatar for LugiaWarior 129. LugiaWarior Lv 1 2 pts. 8,878
  10. Avatar for uihcv 130. uihcv Lv 1 2 pts. 8,874

Comments