Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Contenders 100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228

  1. Avatar for martinf 131. martinf Lv 1 2 pts. 8,865
  2. Avatar for Inkedhands 132. Inkedhands Lv 1 2 pts. 8,852
  3. Avatar for penteplayer 133. penteplayer Lv 1 1 pt. 8,848
  4. Avatar for harvardman 134. harvardman Lv 1 1 pt. 8,846
  5. Avatar for gdnskye 135. gdnskye Lv 1 1 pt. 8,840
  6. Avatar for Dempy 136. Dempy Lv 1 1 pt. 8,839
  7. Avatar for DScott 137. DScott Lv 1 1 pt. 8,836
  8. Avatar for Ronin-Sensei 138. Ronin-Sensei Lv 1 1 pt. 8,824
  9. Avatar for Radeodem8 139. Radeodem8 Lv 1 1 pt. 8,815
  10. Avatar for navn 140. navn Lv 1 1 pt. 8,808

Comments