Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Contenders 100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228

  1. Avatar for rawrjk 211. rawrjk Lv 1 1 pt. 8,018
  2. Avatar for JMStiffler 212. JMStiffler Lv 1 1 pt. 7,870
  3. Avatar for justjustin 213. justjustin Lv 1 1 pt. 7,868
  4. Avatar for zkm 214. zkm Lv 1 1 pt. 7,868
  5. Avatar for alcor29 215. alcor29 Lv 1 1 pt. 7,868
  6. Avatar for dettingen 216. dettingen Lv 1 1 pt. 7,868
  7. Avatar for packer 217. packer Lv 1 1 pt. 7,868
  8. Avatar for Altosummer422 218. Altosummer422 Lv 1 1 pt. 7,868
  9. Avatar for patrickwehrli 219. patrickwehrli Lv 1 1 pt. 7,868

Comments