Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Contenders 100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228

  1. Avatar for phi16 21. phi16 Lv 1 62 pts. 9,292
  2. Avatar for Blipperman 22. Blipperman Lv 1 61 pts. 9,289
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 59 pts. 9,289
  4. Avatar for pmdpmd 24. pmdpmd Lv 1 58 pts. 9,288
  5. Avatar for Timo van der Laan 25. Timo van der Laan Lv 1 56 pts. 9,287
  6. Avatar for Bletchley Park 26. Bletchley Park Lv 1 55 pts. 9,283
  7. Avatar for g_b 27. g_b Lv 1 53 pts. 9,281
  8. Avatar for actiasluna 28. actiasluna Lv 1 52 pts. 9,280
  9. Avatar for hpaege 29. hpaege Lv 1 51 pts. 9,279
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 49 pts. 9,277

Comments