Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Contenders 100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228

  1. Avatar for gcm24 31. gcm24 Lv 1 48 pts. 9,264
  2. Avatar for LociOiling 32. LociOiling Lv 1 47 pts. 9,264
  3. Avatar for Terafold 33. Terafold Lv 1 46 pts. 9,257
  4. Avatar for O Seki To 34. O Seki To Lv 1 45 pts. 9,253
  5. Avatar for decbin 35. decbin Lv 1 43 pts. 9,252
  6. Avatar for kitek314_pl 36. kitek314_pl Lv 1 42 pts. 9,250
  7. Avatar for reefyrob 37. reefyrob Lv 1 41 pts. 9,245
  8. Avatar for weitzen 38. weitzen Lv 1 40 pts. 9,240
  9. Avatar for joremen 39. joremen Lv 1 39 pts. 9,240
  10. Avatar for diamond_dust 40. diamond_dust Lv 1 38 pts. 9,239

Comments