Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Contenders 100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228

  1. Avatar for cobaltteal 41. cobaltteal Lv 1 37 pts. 9,230
  2. Avatar for Anfinsen_slept_here 42. Anfinsen_slept_here Lv 1 36 pts. 9,228
  3. Avatar for steveB 43. steveB Lv 1 35 pts. 9,228
  4. Avatar for smilingone 44. smilingone Lv 1 34 pts. 9,225
  5. Avatar for Norrjane 45. Norrjane Lv 1 33 pts. 9,225
  6. Avatar for viosca 46. viosca Lv 1 32 pts. 9,219
  7. Avatar for jobo0502 47. jobo0502 Lv 1 31 pts. 9,214
  8. Avatar for nemo7731 48. nemo7731 Lv 1 30 pts. 9,210
  9. Avatar for caglar 49. caglar Lv 1 29 pts. 9,201
  10. Avatar for hansvandenhof 50. hansvandenhof Lv 1 28 pts. 9,196

Comments