Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Contenders 100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228

  1. Avatar for crpainter 51. crpainter Lv 1 28 pts. 9,184
  2. Avatar for Deleted player 52. Deleted player 27 pts. 9,181
  3. Avatar for silverberg 53. silverberg Lv 1 26 pts. 9,174
  4. Avatar for Bushman 54. Bushman Lv 1 25 pts. 9,170
  5. Avatar for tarimo 55. tarimo Lv 1 25 pts. 9,169
  6. Avatar for shettler 56. shettler Lv 1 24 pts. 9,169
  7. Avatar for pvc78 57. pvc78 Lv 1 23 pts. 9,168
  8. Avatar for Idiotboy 58. Idiotboy Lv 1 22 pts. 9,167
  9. Avatar for Grom 59. Grom Lv 1 22 pts. 9,165
  10. Avatar for cherry39 60. cherry39 Lv 1 21 pts. 9,165

Comments