Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Contenders 100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228

  1. Avatar for Museka 61. Museka Lv 1 20 pts. 9,161
  2. Avatar for Scopper 62. Scopper Lv 1 20 pts. 9,154
  3. Avatar for goastano 63. goastano Lv 1 19 pts. 9,153
  4. Avatar for tallguy-13088 64. tallguy-13088 Lv 1 19 pts. 9,146
  5. Avatar for jermainiac 65. jermainiac Lv 1 18 pts. 9,139
  6. Avatar for TomTaylor 66. TomTaylor Lv 1 18 pts. 9,130
  7. Avatar for WBarme1234 67. WBarme1234 Lv 1 17 pts. 9,130
  8. Avatar for smholst 68. smholst Lv 1 16 pts. 9,126
  9. Avatar for isaksson 69. isaksson Lv 1 16 pts. 9,119
  10. Avatar for johngran 70. johngran Lv 1 15 pts. 9,116

Comments